CLPS (Colipase, Pancreatic) (APC), Clone: [8A8], Mouse, Monoclonal

Artikelnummer: USB-244774-APC
Artikelname: CLPS (Colipase, Pancreatic) (APC), Clone: [8A8], Mouse, Monoclonal
Artikelnummer: USB-244774-APC
Hersteller Artikelnummer: 244774-APC
Alternativnummer: USB-244774-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IP, WB
Immunogen: CLPS (NP_001823, 23aa-112aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. [provided by RefSeq Applications: Suitable for use in FLISA, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [8A8]
NCBI: 001823
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).