CLUAP1 (Clusterin Associated Protein 1, FLJ13297, KIAA0643), Clone: [6.0e+12], Mouse, Monoclonal

Artikelnummer: USB-244781
Artikelname: CLUAP1 (Clusterin Associated Protein 1, FLJ13297, KIAA0643), Clone: [6.0e+12], Mouse, Monoclonal
Artikelnummer: USB-244781
Hersteller Artikelnummer: 244781
Alternativnummer: USB-244781-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: CLUAP1 (NP_079069.1, 1aa-247aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a full-length recombinant CLUAP1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [6.0e+12]
NCBI: 079069
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.