CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4), Clone: [1B9], Mouse, Monoclonal

Artikelnummer: USB-244786
Artikelname: CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4), Clone: [1B9], Mouse, Monoclonal
Artikelnummer: USB-244786
Hersteller Artikelnummer: 244786
Alternativnummer: USB-244786-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant protein corresponding to aa173-234 from human CMTM4, fused to GST-Tag. MW of the GST tag alone is 26kD.
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1B9]
NCBI: 848933
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4. No preservative added.