CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4) (FITC), Clone: [1B9], Mouse, Monoclonal

Artikelnummer: USB-244786-FITC
Artikelname: CMTM4 (CKLF-like MARVEL Transmembrane Domain Containing 4, CKLFSF4) (FITC), Clone: [1B9], Mouse, Monoclonal
Artikelnummer: USB-244786-FITC
Hersteller Artikelnummer: 244786-FITC
Alternativnummer: USB-244786-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: CMTM4 (NP_848933, 173aa-234aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1B9]
NCBI: 848933
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).