CNAP1 (AAH28182, 1240aa-1339aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNAP1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
