CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 490), Clone: [4C9], Mouse, Monoclonal

Artikelnummer: USB-244790-ML490
Artikelname: CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 490), Clone: [4C9], Mouse, Monoclonal
Artikelnummer: USB-244790-ML490
Hersteller Artikelnummer: 244790-ML490
Alternativnummer: USB-244790-ML490-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: CNAP1 (AAH28182, 1240aa-1339aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. Mouse monoclonal antibody raised against a partial recombinant CNAP1. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4C9]
NCBI: 28182
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.