CNO (Cappuccino Homolog (mouse), BCAS4L, FLJ11230), Clone: [6C3], Mouse, Monoclonal

Artikelnummer: USB-244803
Artikelname: CNO (Cappuccino Homolog (mouse), BCAS4L, FLJ11230), Clone: [6C3], Mouse, Monoclonal
Artikelnummer: USB-244803
Hersteller Artikelnummer: 244803
Alternativnummer: USB-244803-200
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: CNO (NP_060836, 108aa-217aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and is a model for Hermansky-Pudlak syndrome. The encoded protein may play a role in intracellular vesicular trafficking. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEAFVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPCCSERPQL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [6C3]
NCBI: 060836
Reinheit: Ascites
Formulierung: Supplied as a liquid.