CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H), Clone: [2.0e+10], Mouse, Monoclonal

Produktübersicht

• Artikelname: CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H), Clone: [2.0e+10], Mouse, Monoclonal
• Artikelnummer: USB-244805
• Hersteller Artikelnummer: 244805
• Alternativnummer: USB-244805-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA
• Immunogen: CNOT2 (NP_055330, 441aa-540aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Mouse monoclonal antibody raised against a partial recombinant CNOT2. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [2.0e+10]
• NCBI: 055330
• Reinheit: Purified
• Formulierung: Supplied as a liquid in PBS, pH 7.4.