CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1), Clone: [1A10], Mouse, Monoclonal

Artikelnummer: USB-244815
Artikelname: CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1), Clone: [1A10], Mouse, Monoclonal
Artikelnummer: USB-244815
Hersteller Artikelnummer: 244815
Alternativnummer: USB-244815-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: CNTLN (NP_060208, 971aa-1070aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNTLN. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A10]
NCBI: 060208
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.