CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1) (HRP), Clone: [1A10], Mouse, Monoclonal

Artikelnummer: USB-244815-HRP
Artikelname: CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1) (HRP), Clone: [1A10], Mouse, Monoclonal
Artikelnummer: USB-244815-HRP
Hersteller Artikelnummer: 244815-HRP
Alternativnummer: USB-244815-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: CNTLN (NP_060208, 971aa-1070aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant CNTLN. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A10]
NCBI: 060208
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).