CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1) (MaxLight 550), Clone: [1A10], Mouse, Monoclonal

Artikelnummer: USB-244815-ML550
Artikelname: CNTLN (Centlein, Centrosomal Protein, C9orf101, C9orf39, FLJ20276, FLJ25636, RP11-340N12.1, bA340N12.1) (MaxLight 550), Clone: [1A10], Mouse, Monoclonal
Artikelnummer: USB-244815-ML550
Hersteller Artikelnummer: 244815-ML550
Alternativnummer: USB-244815-ML550-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: CNTLN (NP_060208, 971aa-1070aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Mouse monoclonal antibody raised against a partial recombinant CNTLN. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A10]
NCBI: 060208
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.