COASY (Coenzyme A Synthase, DPCK, FLJ35179, NBP, PPAT, UKR1, pOV-2) (PE), Clone: [2A12], Mouse, Monoclonal

Artikelnummer: USB-244818-PE
Artikelname: COASY (Coenzyme A Synthase, DPCK, FLJ35179, NBP, PPAT, UKR1, pOV-2) (PE), Clone: [2A12], Mouse, Monoclonal
Artikelnummer: USB-244818-PE
Hersteller Artikelnummer: 244818-PE
Alternativnummer: USB-244818-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: COASY (NP_079509, 461aa-564aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. COASY is a bifunctional enzyme that catalyzes the 2 last steps in CoA synthesis. These activities are performed by 2 separate enzymes, phosphopantetheine adenylyltransferase (PPAT, EC 2.7.7.3) and dephospho-CoA kinase (DPCK, EC 2.7.1.24), in prokaryotes (Daugherty et al., 2002 [PubMed 11923312]).[supplied by OMIM Applications: Suitable for use in Western Blot, Immunohistochemistry and FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDGLSEMouse monoclonal antibody raised against a partial recombinant COASY.QSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2A12]
NCBI: 079509
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).