COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1), Clone: [1G6], Mouse, Monoclonal

Artikelnummer: USB-244829
Artikelname: COL21A1 (Collagen, Type XXI, alpha 1, COLA1L, DKFZp564B052, FLJ39125, FLJ44623, FP633, MGC26619, dJ682J15.1, dJ708F5.1), Clone: [1G6], Mouse, Monoclonal
Artikelnummer: USB-244829
Hersteller Artikelnummer: 244829
Alternativnummer: USB-244829-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: COL21A1 (NP_110447, 221aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1G6]
NCBI: 110447
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.