COL4A6 (Collagen, Type IV, alpha 6, MGC88184) (HRP), Clone: [2F1], Mouse, Monoclonal
Artikelnummer:
USB-244837-HRP
Hersteller Artikelnummer:
244837-HRP
Alternativnummer:
USB-244837-HRP-100
Hersteller:
US Biological
Wirt:
Mouse
Kategorie:
Antikörper
Applikation:
ELISA
Immunogen:
COL4A6 (AAH05305, 1aa-73aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene, alpha 5 type IV collagen, so that the gene pair shares a common promoter. Deletions in the alpha 5 gene that extend into the alpha 6 gene result in diffuse leiomyomatosis accompanying the X-linked Alport syndrome caused by the deletion in the alpha 5 gene. Two splice variants have been identified for this gene. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLINKLWLLLVTLCLTEELMouse monoclonal antibody raised against a full-length recombinant COL4A6.GEKSYGKPCGGQDCSGSCQCFPEKGARHNLQLLNDMAGRLYHFSEVLPNLF Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
