COL4A6 (Collagen, Type IV, alpha 6, MGC88184) (MaxLight 550), Clone: [2F1], Mouse, Monoclonal

Artikelnummer: USB-244837-ML550
Artikelname: COL4A6 (Collagen, Type IV, alpha 6, MGC88184) (MaxLight 550), Clone: [2F1], Mouse, Monoclonal
Artikelnummer: USB-244837-ML550
Hersteller Artikelnummer: 244837-ML550
Alternativnummer: USB-244837-ML550-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: COL4A6 (AAH05305, 1aa-73aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene, alpha 5 type IV collagen, so that the gene pair shares a common promoter. Deletions in the alpha 5 gene that extend into the alpha 6 gene result in diffuse leiomyomatosis accompanying the X-linked Alport syndrome caused by the deletion in the alpha 5 gene. Two splice variants have been identified for this gene. [provided by RefSeq Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLINKLWLLLVTLCLTEELMouse monoclonal antibody raised against a full-length recombinant COL4A6.GEKSYGKPCGGQDCSGSCQCFPEKGARHNLQLLNDMAGRLYHFSEVLPNLF Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2F1]
NCBI: 05305
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.