COL5A2 (Collagen, Type V, alpha 2, MGC105115) (Biotin), Clone: [3G11], Mouse, Monoclonal

Artikelnummer: USB-244839-BIOTIN
Artikelname: COL5A2 (Collagen, Type V, alpha 2, MGC105115) (Biotin), Clone: [3G11], Mouse, Monoclonal
Artikelnummer: USB-244839-BIOTIN
Hersteller Artikelnummer: 244839-Biotin
Alternativnummer: USB-244839-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Immunogen: COL5A2 (NP_000384, 41aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3G11]
NCBI: 000384
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.