GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3), Mouse

Artikelnummer: USB-246554
Artikelname: GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3), Mouse
Artikelnummer: USB-246554
Hersteller Artikelnummer: 246554
Alternativnummer: USB-246554-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: GEMIN7 (NP_001007270.1, 1aa-131aa) full-length human protein.
The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear gems (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 001007270
Reinheit: Purified
Formulierung: Supplied as a liquid. No preservative added.