GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3), Clone: [4H6], Mouse, Monoclonal

Artikelnummer: USB-246555
Artikelname: GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3), Clone: [4H6], Mouse, Monoclonal
Artikelnummer: USB-246555
Hersteller Artikelnummer: 246555
Alternativnummer: USB-246555-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Immunogen: GEMIN7 (NP_078983.1, 43aa-131aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear gems (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4H6]
NCBI: 078983
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.