IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (Biotin), Clone: [4B1], Mouse, Monoclonal

Artikelnummer: USB-247771-BIOTIN
Artikelname: IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (Biotin), Clone: [4B1], Mouse, Monoclonal
Artikelnummer: USB-247771-BIOTIN
Hersteller Artikelnummer: 247771-Biotin
Alternativnummer: USB-247771-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: IVNS1ABP (NP_006460.2, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B1]
NCBI: 006460
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.