IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (HRP), Clone: [4B1], Mouse, Monoclonal

Artikelnummer: USB-247771-HRP
Artikelname: IVNS1ABP (influenza Virus NS1A Binding Protein, DKFZp686K06216, FLARA3, FLJ10069, FLJ10411, FLJ10962, FLJ35593, FLJ36593, HSPC068, KIAA0850, ND1, NS-1, NS1-BP, NS1BP) (HRP), Clone: [4B1], Mouse, Monoclonal
Artikelnummer: USB-247771-HRP
Hersteller Artikelnummer: 247771-HRP
Alternativnummer: USB-247771-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: IVNS1ABP (NP_006460.2, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B1]
NCBI: 006460
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).