Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist. Synonyms: Glucagon (1-37), Enteroglucagon CAS No: 62340-29-8 Molecular Formula: C192H295N59O60S Molecular Weight: 4421.86 Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA Appearance: White to off-white solid Purity: ~81% NPC Solubility: Water: 1mg/ml Storage and Stability: May be stored at RT for short-term only. Long-term storage is recommended at -20C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molekulargewicht:
4421.86
Reinheit:
~81% NPC
Formulierung:
White to off-white solid
CAS Nummer:
[62340-29-8]
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
