Glucagon Like Peptide-2, Human (GLP-2)

Artikelnummer: USB-298174
Artikelname: Glucagon Like Peptide-2, Human (GLP-2)
Artikelnummer: USB-298174
Hersteller Artikelnummer: 298174
Alternativnummer: USB-298174-100,USB-298174-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Source: Synthetic human Glucagon Like Peptide-2. Uniprot/Accession: P01275 Amino Acid Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P01275
Reinheit: 90% (HPLC)
Formulierung: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.