Parathyroid Hormone, Rat, aa1-34 (PTH, Parathyrin)

Artikelnummer: USB-298235
Artikelname: Parathyroid Hormone, Rat, aa1-34 (PTH, Parathyrin)
Artikelnummer: USB-298235
Hersteller Artikelnummer: 298235
Alternativnummer: USB-298235-100,USB-298235-1
Hersteller: US Biological
Kategorie: Molekularbiologie
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P04089
Reinheit: 95% (HPLC)
Formulierung: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.