Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)

Artikelnummer: USB-298243
Artikelname: Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)
Artikelnummer: USB-298243
Hersteller Artikelnummer: 298243
Alternativnummer: USB-298243-100,USB-298243-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Source: Synthetic human Pro-Atrial Natriuretic Peptide, aa1-30 AA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P01160
Reinheit: ~95% (HPLC)
Formulierung: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.