Sperm-Associated Antigen 11B, Isoform C, Human, aa52-88 (SPAG11B, Human Epididymis-Specific Protein 2, He2, Protein EP2, Sperm Antigen HE2)
Artikelnummer:
USB-298272
Hersteller Artikelnummer:
298272
Alternativnummer:
USB-298272-100,USB-298272-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008] Source: Synthetic human SPAG11B, isoform C AA Sequence: LKVVDCRRSEGFCQEYCNYMETQVGYCSKKKDACCLH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.