Synthetic human Thymosin B15, aa1-45 AA Sequence: MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile 0.1% acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
