ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)

Artikelnummer: USB-298328
Artikelname: ATAD2B, Recombinant, Human, aa953-1080, GST-tag (KIAA1240, AAA Domain Containing 2B, Variant 1)
Artikelnummer: USB-298328
Hersteller Artikelnummer: 298328
Alternativnummer: USB-298328-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The protein encoded by this gene belongs to the AAA ATPase family. This family member includes an N-terminal bromodomain. It has been found to be localized to the nucleus, partly to replication sites, consistent with a chromatin-related function. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2014] Source: Recombinant protein corresponding to aa953-1080 from bromodomain human ATAD2B, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEE NTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYL TAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIK E Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 42
NCBI: 017552
UniProt: Q9ULI0
Reinheit: Highly Purified (~95%)
Formulierung: Supplied as a liquid in 40mM Tris, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.