BAZ1B, Recombinant, Human, aa1335-1450, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)

Produktübersicht

• Artikelname: BAZ1B, Recombinant, Human, aa1335-1450, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)
• Artikelnummer: USB-298332
• Hersteller Artikelnummer: 298332
• Alternativnummer: USB-298332-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to single bromodomain, aa1335-1450, from human BAZ1B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.7kD AA Sequence: MHHHHHHKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPM DFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALL HKHLPGHPYV Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 14.7
• NCBI: 032408
• UniProt: Q9UIG0
• Reinheit: Highly Purified (~90%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.