CBX2, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 2, SRXY5, Cell Division Cycle Associated 6, CDCA6)
Artikelnummer:
USB-298386
- Bilder (0)
| Artikelname: | CBX2, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 2, SRXY5, Cell Division Cycle Associated 6, CDCA6) |
| Artikelnummer: | USB-298386 |
| Hersteller Artikelnummer: | 298386 |
| Alternativnummer: | USB-298386-100 |
| Hersteller: | US Biological |
| Kategorie: | Molekularbiologie |
| Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A Lys119, rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression. Source: Recombinant protein corresponding to aa2-90 from human chromobox homolog 2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEELSS VGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEH EKEVQNRKRGKRPRGRPRKLTAMSSCS Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
