CBX7, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 7)

Produktübersicht

• Artikelname: CBX7, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 7)
• Artikelnummer: USB-298388
• Hersteller Artikelnummer: 298388
• Alternativnummer: USB-298388-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa2-90 from human CBX7, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD AA Sequence: MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDP RLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 11.6
• NCBI: 175709
• UniProt: O95931
• Reinheit: Highly Purified (~90%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.