CECR2, Recombinant, Human, aa430-543, His-Tag (Cat Eye Syndrome Chromosome Region, Candidate 2)

Artikelnummer: USB-298400
Artikelname: CECR2, Recombinant, Human, aa430-543, His-Tag (Cat Eye Syndrome Chromosome Region, Candidate 2)
Artikelnummer: USB-298400
Hersteller Artikelnummer: 298400
Alternativnummer: USB-298400-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Part of the CERF (CECR2-containing-remodeling factor) complex, which facilitates the perturbation of chromatin structure in an ATP-dependent manner. May be involved through its interaction with LRPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis. Source: Recombinant protein corresponding to aa430-543 from human Bromodomain CECR2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.4kD AA Sequence: MHHHHHHTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPM DISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAM MKHFPGED Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 14.4
NCBI: 031413
UniProt: Q9BXF3
Reinheit: Purified (~70%)
Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.