CHD2, Recombinant, Human, aa260-456, GST-Tag (Chromodomain Helicase DNA Binding Protein 2)

Artikelnummer: USB-298401
Artikelname: CHD2, Recombinant, Human, aa260-456, GST-Tag (Chromodomain Helicase DNA Binding Protein 2)
Artikelnummer: USB-298401
Hersteller Artikelnummer: 298401
Alternativnummer: USB-298401-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Source: Recombinant protein corresponding to aa260-456 from human CHD2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSETIE KVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTW ESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDVEYFNCQQELASELNKQY QIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIG KKFQNCIDSFHSRNNSKTIPTR Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 49.3
NCBI: 001271
UniProt: O14647
Reinheit: Purified (~82%)
Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.