EPHA4, Recombinant, Human, aa610-887, GST-tag (Ephrin Receptor A4, TYRO1, SEK, HEK8)

Artikelnummer: USB-298407
Artikelname: EPHA4, Recombinant, Human, aa610-887, GST-tag (Ephrin Receptor A4, TYRO1, SEK, HEK8)
Artikelnummer: USB-298407
Hersteller Artikelnummer: 298407
Alternativnummer: USB-298407-10
Hersteller: US Biological
Kategorie: Molekularbiologie
EPHA4 also known as EPH receptor A4, belongs to the ephrin receptor subfamily of protein-tyrosine kinases which have been implicated in mediating developmental events, particularly in the nervous system. The EPHA4 ligand ephrin-A3 is localized to the astrocytic processes that envelop the spine. Activation of EPHA4 by ephrin-A3 induces spinal retraction and reduces spine density and inhibits the interaction distorted spine shape and organization. EPHA4-null mice possess defects in the corticospinal tract and anterior commissure indicating a model in which an ephrin ligand on the axons senses EPHA4 on spinal cord cells surrounding the corticospinal tract. Source: Recombinant protein corresponding to aa610-887 from human EPHA4, fused to GST-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~58kD Specific Activity: 61pmol/min/ug AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHLEVLFQGPLGSREFAKEIDASCIKIEK VIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHL EGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVH RDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSA SDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCW QKERSDRPKFGQIVNMLDKLIRNPNS Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Assay Conditions: Assay was done in Kinase buffer containing 0.2mM DTT using Poly-(Glu4:Tyr)-biotin substrate (0.2mg/ml) and 20um ATP. Reaction was done at 30C for 40 min. Amount of ATP transferred was calculated using Kinase-Glo reagent. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 58
NCBI: 004438
Reinheit: Highly Purified (~90%)
Formulierung: Supplied as a liquid in 50mM Tris-HCl, pH 7.5, 150mM sodium chloride, 10mM glutathione, 0.1mM EDTA, 0.25mM DTT, 0.1mM PMSF, 25% glycerol.