ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Activation-Inducible Lymphocyte Immunomediatory Molecule, AILIM, CD278, CVID1)
Artikelnummer:
USB-298414
Hersteller Artikelnummer:
298414
Alternativnummer:
USB-298414-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq, Jul 2008]. Source: Recombinant Fc fusion protein corresponding to aa21-140 from human ICOS at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40.2kD, runs at a higher MW by SDS-PAGE due to glycosylation Amino Acid Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Applications: Suitable for use in the study of protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.