L3MBTL3, Recombinant, Human, aa229-547, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 3)

Artikelnummer: USB-298425
Artikelname: L3MBTL3, Recombinant, Human, aa229-547, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 3)
Artikelnummer: USB-298425
Hersteller Artikelnummer: 298425
Alternativnummer: USB-298425-100
Hersteller: US Biological
Kategorie: Molekularbiologie
PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Source: Recombinant protein corresponding to aa229-547 from human L3MBTL3, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.6kD AA Sequence: MHHHHHHKKAWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPE HQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPK GYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVA TVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHF SWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHR VKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPL Applications: Suitable for use in the study of Polycomb group (PcG) proteins, protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 37.6
NCBI: 032438
UniProt: Q96JM7
Reinheit: Purified (~88%)
Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 19mM imidazole, 0.005% Tween 20, 20% glycerol.