PB1 (BD4), Recombinant, Human, aa528-618, His-Tag (PBRM1, BRG1-Associated Factor 180, Variant 2, Polybromo 1)

Artikelnummer: USB-298440
Artikelname: PB1 (BD4), Recombinant, Human, aa528-618, His-Tag (PBRM1, BRG1-Associated Factor 180, Variant 2, Polybromo 1)
Artikelnummer: USB-298440
Hersteller Artikelnummer: 298440
Alternativnummer: USB-298440-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. [provided by RefSeq, Feb 2012]. Source: Recombinant protein corresponding to bromodomain 4, aa528-618, from human polybromo 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD AA Sequence: MHHHHHHNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRND KYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLL Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 11.7
NCBI: 018313
UniProt: Q86U86
Reinheit: Purified (~75%)
Formulierung: Supplied as a liquid in 50mM Tris-HCl, pH 8.0, 150mM sodium chloride, 10% glycerol.