PCGF6, Recombinant, Human, aa2-350, GST-tag (Polycomb Group RING Finger Protein 6, Mel18 And Bmi1-Like RING Finger Protein, MBLR, RNF134)

Artikelnummer: USB-298443
Artikelname: PCGF6, Recombinant, Human, aa2-350, GST-tag (Polycomb Group RING Finger Protein 6, Mel18 And Bmi1-Like RING Finger Protein, MBLR, RNF134)
Artikelnummer: USB-298443
Hersteller Artikelnummer: 298443
Alternativnummer: USB-298443-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional repressor that modulates the levels of histone H3K4Me3 by activating KDM5D histone demethylase. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Source: Recombinant protein corresponding to aa2-350 from human PCGF6, fused to GST-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~65.7kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPLVPRGSPGEFEGVA VVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPE LEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPL YNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKVL ESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPA CQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 65.7
NCBI: 001011663
UniProt: Q9BYE7
Reinheit: Purified (~86%)
Formulierung: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.