PD-L1, Recombinant, Human, aa19-239, FLAG-Tag (CD274, Programmed Cell Death 1 Ligand 1, CD274 and B7 Homolog 1, B7-H1, PDCD1 Ligand 1, Programmed Death Ligand 1, PDCD1L1)
Artikelnummer:
USB-298445
- Bilder (0)
| Artikelname: | PD-L1, Recombinant, Human, aa19-239, FLAG-Tag (CD274, Programmed Cell Death 1 Ligand 1, CD274 and B7 Homolog 1, B7-H1, PDCD1 Ligand 1, Programmed Death Ligand 1, PDCD1L1) |
| Artikelnummer: | USB-298445 |
| Hersteller Artikelnummer: | 298445 |
| Alternativnummer: | USB-298445-50 |
| Hersteller: | US Biological |
| Kategorie: | Molekularbiologie |
| Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Source: Recombinant protein corresponding to aa19-239 from human PD-L1, fused to FLAG-tag at C-terminal, expressed in HEK293 cell expression system. Molecular Weight: ~26kD, protein runs at a higher MW by SDS-PAGE due to glycosylation AA Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY NKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFN VTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTDYKDDDDK Applications: Suitable for use in studying protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
