PRKCBP1, Recombinant, Human, aa160-280, GST-tag (ZMYND8, Zinc Finger MYND-Type Containing 8, CTCL Tumor Antigen Se14-3, RACK7)
Artikelnummer:
USB-298448
- Bilder (0)
| Artikelname: | PRKCBP1, Recombinant, Human, aa160-280, GST-tag (ZMYND8, Zinc Finger MYND-Type Containing 8, CTCL Tumor Antigen Se14-3, RACK7) |
| Artikelnummer: | USB-298448 |
| Hersteller Artikelnummer: | 298448 |
| Alternativnummer: | USB-298448-100 |
| Hersteller: | US Biological |
| Kategorie: | Molekularbiologie |
| The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa160-280 from human bromodomain PRKCBP1, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETQSK AMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNA KKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYL Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
