TRIM28, Recombinant, Human, aa685-815, His-Tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-Beta, RNF96)

Produktübersicht

• Artikelname: TRIM28, Recombinant, Human, aa685-815, His-Tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-Beta, RNF96)
• Artikelnummer: USB-298487
• Hersteller Artikelnummer: 298487
• Alternativnummer: USB-298487-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa685-815 from human bromodomain TRIM28, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.6kD AA Sequence: MHHHHHHDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQ PGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRF FETRMNEAFGDTKFSAVLVEPPPM Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 15.6
• NCBI: 005762
• UniProt: Q13263
• Reinheit: Purified (~87%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.