WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1, BRWD1, WDR9, WD Repeat-Containing Protein 9)

Artikelnummer: USB-298492
Artikelname: WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1, BRWD1, WDR9, WD Repeat-Containing Protein 9)
Artikelnummer: USB-298492
Hersteller Artikelnummer: 298492
Alternativnummer: USB-298492-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates multiple transcript variants encoding distinct isoforms. In mouse, this gene encodes a nuclear protein that has a polyglutamine-containing region that functions as a transcriptional activation domain which may regulate chromatin remodelling and associates with a component of the SWI/SNF chromatin remodelling complex.[provided by RefSeq, Jun 2011]. Source: Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human bromodomain and WD repeat domain containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.2kD AA Sequence: MHHHHHHIRATNYVESNWKKQCKELVNLIF QCEDSEPFRQPVDLVEYPDYRDIIDTPMDF GTVRETLDAGNYDSPLEFCKDIRLIFSNAKA YTPNKRSKIYSMTLRLSALFEEKMKKISSDFK IGQKFNEKLRRSQ Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 16.2
NCBI: 018963
UniProt: Q9NSI6
Reinheit: Purified (~82%)
Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.