Yes1, Recombinant, Human, aa2-543, GST-tag (Proto-Oncogene Tyrosine Protein Kinase YES, C-yes, HsT441, P61-YES)

Produktübersicht

• Artikelname: Yes1, Recombinant, Human, aa2-543, GST-tag (Proto-Oncogene Tyrosine Protein Kinase YES, C-yes, HsT441, P61-YES)
• Artikelnummer: USB-298494
• Hersteller Artikelnummer: 298494
• Alternativnummer: USB-298494-10
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

YES1 is the cellular homolog of the Yamaguchi sarcoma virus oncogene that has tyrosine kinase activity and belongs to the SRC family. YES1 lies in close proximity to thymidylate synthase gene on chromosome 18 and chromosome 22. The activation of YES1 may play a significant role in the malignant transformation of hepatocytes, and is important for maintaining embryonic stem cells in an undifferentiated state. YES1 is a useful marker to detect early-stage hepatocellular carcinoma, and it plays a key role in the tumorigenesis and metastasis of gastric cancer. YES1 induction results in increased cancer cell motility suggesting that YES1 may promote cancer spread and metastasis rather than tumor growth. Source: Recombinant protein corresponding to aa2-543 from full length human YES1, fused to GST-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~88kD Specific Activity: 200pmole/min/ug Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHLEVLFQGPLGSGIQRPTSTSSLVAAAG CIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPF GGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINN TEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF LVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEH ADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTK VAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEG DGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDN EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQ VERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN L Assay Conditions: Assay was done in kinase buffer containing 0.2mM DTT using Poly-(Glu4:Tyr)-biotin substrate (0.2mg/ml) and 20um ATP. Reaction was done at 30C for 45 min. Amount of ATP transferred was calculated using Kinase-Glo reagent. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 88
• NCBI: 005433
• UniProt: P07947
• Reinheit: Purified (~70%)
• Formulierung: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 3mM DTT, 20% glycerol.