Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human

Artikelnummer: USB-348040
Artikelname: Fibroblast Growth Factor 1, active (FGF1), Recombinant, Human
Artikelnummer: USB-348040
Hersteller Artikelnummer: 348040
Alternativnummer: USB-348040-10, USB-348040-100, USB-348040-500
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. {ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:20145243, ECO:0000269|PubMed:8663044}. Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5ng/ml, corresponding to a specific activity of > 2.0x10e6 IU/mg in the presence of 10ug/ml of heparin. Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D Molecular Weight: 16.0kD PubMed ID: 3523756, 2590193, 2474753, 1693186, 1717925, 1372643, 7504343, 14702039, 15372022, 15489334, 2393407, 2427112, 3527167, 3778488, 3964259, 3732516, 1885605, 8663044, 11432880, 11964394, 16597617, 18400376, 20863990, 15863030, 20094046, 22321063, 1702556, 8652550, 9655399, 10830168, 11069186, 10618369, 11847269, 14732692, 7521397, 8950275, 9719643, 20145243, 20220137 Gene Name: FGF1, FGFA Swiss Prot: P05230 Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months at -20C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16
UniProt: P05230
Reinheit: 95% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized from 0.2um filtered PBS, pH 7.4