HSPA5, CT (GRP78, Heat shock 70kD protein 5, Glucose-regulated protein 78kD, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, BiP), Rabbit

Artikelnummer: USB-350670
Artikelname: HSPA5, CT (GRP78, Heat shock 70kD protein 5, Glucose-regulated protein 78kD, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, BiP), Rabbit
Artikelnummer: USB-350670
Hersteller Artikelnummer: 350670
Alternativnummer: USB-350670-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: Synthetic peptide corresponding to aa592-624, ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE, of human GRP78 BiP at C-terminal.
HSPA5 (heat shock 70kD protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P11021
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.