Integrin alpha 2B, CT (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16, Platelet glycoprotein IIb of IIb/IIIa complex, Antigen CD41), Rabbit

Artikelnummer: USB-350688
Artikelname: Integrin alpha 2B, CT (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16, Platelet glycoprotein IIb of IIb/IIIa complex, Antigen CD41), Rabbit
Artikelnummer: USB-350688
Hersteller Artikelnummer: 350688
Alternativnummer: USB-350688-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: Synthetic peptide corresponding to aa677-711, EAELAVHLPQGAHYMRALSNVEGFERLICNQK -KEN, of human ITGA2B at C-terminal.
Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P08514
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.