PDIA3, CT (ERp57, Protein disulfide-isomerase A3, Protein disulfide isomerase family A member 3, Disulfide Isomerase ER-60, Endoplasmic Reticulum Resident Protein 60, ER Protein 60, ERp60, 58kD Microsomal Protein, p58, Endoplasmic
PDIA3, CT (ERp57, Protein disulfide-isomerase A3, Protein disulfide isomerase family A member 3, Disulfide Isomerase ER-60, Endoplasmic Reticulum Resident Protein 60, ER Protein 60, ERp60, 58kD Microsomal Protein, p58, Endoplasmic
PDIA3, CT (ERp57, Protein disulfide-isomerase A3, Protein disulfide isomerase family A member 3, Disulfide Isomerase ER-60, Endoplasmic Reticulum Resident Protein 60, ER Protein 60, ERp60, 58kD Microsomal Protein, p58, Endoplasmic
Artikelnummer:
USB-350777
Hersteller Artikelnummer:
350777
Alternativnummer:
USB-350777-100
Hersteller:
US Biological
Wirt:
Rabbit
Kategorie:
Antikörper
Applikation:
IHC, WB
Immunogen:
Synthetic peptide corresponding to aa471-505, RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL, of human PDIA3 at C-terminal.
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
