Brain Natriuretic Peptide (BNP), Recombinant, Human

Produktübersicht

• Artikelname: Brain Natriuretic Peptide (BNP), Recombinant, Human
• Artikelnummer: USB-359894
• Hersteller Artikelnummer: 359894
• Alternativnummer: USB-359894-20,USB-359894-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Recombinant protein corresponding to human Brain Natriuretic Peptide (BNP), a single non-glycosylated polypeptide chain containing 32aa, expressed in E. coli. Molecular Weight: ~3.5kD (32aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 3.5
• Reinheit: 97% (SDS-PAGE, HPLC). Endotoxin: 1EU/mg (LAL)
• Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml.