Rickettsia rickettsii is an obligate intracellular Gram-negative bacterium that causes Rocky Mountain spotted fever (RMSF), a serious life-threatening disease. RMSF was first found in the Snake River Valley of Idaho in 1896 and described by Edward E Maxey [1]. Patients suffering from RMSF usually present fever, headache, myalgias, and rash, as well as a history of tick bite or contact. For serious R. rickettsii infection, patients will develop symptoms of acute lung edema, renal failure, and/or encephalitis [2], [3] due to wide spread vasculitis caused by rickettsial infection of endothelial cells lining the small blood vessels in these vital organs [4], [5]. Recombinant protein corresponding to aa46-122 of Rickettsia 17kD Surface fused with His tag and two protease cleavage sites (Enterokinase: DDDDK and TEV protease: ENLYFQG at N-terminus MASTTHHHHHHDTDIPTTSGSSNSGSSSTGSSNSGSSSTGSSGTGSGGGSRPDDDDKENLYFQGHM) expressed in E.coli. UniProt: B8LAD2. Source: Recombinant, E. coli Purity: 90% (SDS-PAGE under reducing conditions) Concentration: ~1mg/ml Appearance: Supplied as a liquid in 10mM sodium phosphate pH 7.5, 0.5M sodium chloride, 1M Imidazole. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
