IMPA2 (IMP.18P, Inositol Monophosphatase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol Monophosphatase A2), Rabbit

Produktübersicht

• Artikelname: IMPA2 (IMP.18P, Inositol Monophosphatase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol Monophosphatase A2), Rabbit
• Artikelnummer: USB-368173
• Hersteller Artikelnummer: 368173
• Alternativnummer: USB-368173-100
• Hersteller: US Biological
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Immunogen: IMPA2 (NP_055029.1, aa1-288) full-length human protein.

Produktbeschreibung

Can use myo-inositol monophosphates, scylloinositol 1,4- diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2- AMP as substrates. Has been implicated as the pharmacological target for lithium Li(+) action in brain. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• NCBI: 055029
• UniProt: O14732
• Reinheit: Purified
• Formulierung: Supplied as a liquid in PBS, pH 7.4.