S100B (Protein S100-B, S-100 Protein beta Chain, S-100 Protein Subunit beta, S100 Calcium-binding Protein B, NEF, S100, S100beta), Clone: [1A19], Mouse, Monoclonal

Artikelnummer: USB-368327
Artikelname: S100B (Protein S100-B, S-100 Protein beta Chain, S-100 Protein Subunit beta, S100 Calcium-binding Protein B, NEF, S100, S100beta), Clone: [1A19], Mouse, Monoclonal
Artikelnummer: USB-368327
Hersteller Artikelnummer: 368327
Alternativnummer: USB-368327-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: S100B (NP_006263.1, aa1-92) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21, however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimers disease, Downs syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFM AFVAMVTTACHEFFEHE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A19]
NCBI: 006263
UniProt: P04271
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.